Lineage for d1vr4a1 (1vr4 A:1-103)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007999Fold d.230: Dodecin subunit-like [88797] (9 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 3008222Superfamily d.230.5: YbjQ-like [117782] (2 families) (S)
    pentamer, beta/alpha-propeller; additional short beta-strands promote oligomeric assembly
  5. 3008223Family d.230.5.1: YbjQ-like [117783] (3 proteins)
    Pfam PF01906; DUF 74, UPF0145
  6. 3008224Protein Hypothetical protein BC1012 [142892] (1 species)
  7. 3008225Species Bacillus cereus [TaxId:1396] [142893] (2 PDB entries)
    Uniprot Q81H14 1-103
  8. 3008230Domain d1vr4a1: 1vr4 A:1-103 [120432]
    Other proteins in same PDB: d1vr4b_, d1vr4c_, d1vr4d_, d1vr4e_

Details for d1vr4a1

PDB Entry: 1vr4 (more details), 2.09 Å

PDB Description: crystal structure of mcsg target apc22750 from bacillus cereus
PDB Compounds: (A:) hypothetical protein APC22750

SCOPe Domain Sequences for d1vr4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vr4a1 d.230.5.1 (A:1-103) Hypothetical protein BC1012 {Bacillus cereus [TaxId: 1396]}
mivtttsgiqgkeiieyidivngeaimganivrdlfasvrdvvggragsyesklkeardi
amdemkelakqkganaivgvdvdyevvrdgmlmvavsgtavri

SCOPe Domain Coordinates for d1vr4a1:

Click to download the PDB-style file with coordinates for d1vr4a1.
(The format of our PDB-style files is described here.)

Timeline for d1vr4a1: