Lineage for d1vqza2 (1vqz A:1-241)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574231Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2574232Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2574581Family d.104.1.3: LplA-like [143642] (6 proteins)
    part of Pfam PF03099
  6. 2574595Protein LplA-like protein SP1160, N-terminal domain [143645] (1 species)
  7. 2574596Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [143646] (1 PDB entry)
    Uniprot Q97QP1 1-241
  8. 2574597Domain d1vqza2: 1vqz A:1-241 [120427]
    Other proteins in same PDB: d1vqza1, d1vqza3
    complexed with edo, unl

Details for d1vqza2

PDB Entry: 1vqz (more details), 1.99 Å

PDB Description: crystal structure of a putative lipoate-protein ligase a (sp_1160) from streptococcus pneumoniae tigr4 at 1.99 a resolution
PDB Compounds: (A:) lipoate-protein ligase, putative

SCOPe Domain Sequences for d1vqza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqza2 d.104.1.3 (A:1-241) LplA-like protein SP1160, N-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mkyiinhsndtafnialeeyafkhlldedqifllwinkpsiivgrhqntieeinrdyvre
ngievvrrisgggavyhdlnnlnytiiskedenkafdfksfstpvintlaqlgvkaeftg
rndleidgkkfcgnaqayingrimhhgcllfdvdlsvlanalkvskdkfeskgvksvrar
vtniinelpkkitvekfrdllleymkkeypemteyvfseeelaeinrikdtkfgtwdwny
g

SCOPe Domain Coordinates for d1vqza2:

Click to download the PDB-style file with coordinates for d1vqza2.
(The format of our PDB-style files is described here.)

Timeline for d1vqza2: