Lineage for d1vqza2 (1vqz A:1-241)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730671Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 730672Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (3 families) (S)
  5. 730914Family d.104.1.3: LplA-like [143642] (2 proteins)
    part of Pfam PF03099
  6. 730918Protein LplA-like protein SP1160, N-terminal domain [143645] (1 species)
  7. 730919Species Streptococcus pneumoniae [TaxId:1313] [143646] (1 PDB entry)
  8. 730920Domain d1vqza2: 1vqz A:1-241 [120427]
    Other proteins in same PDB: d1vqza1
    complexed with edo, unl

Details for d1vqza2

PDB Entry: 1vqz (more details), 1.99 Å

PDB Description: crystal structure of a putative lipoate-protein ligase a (sp_1160) from streptococcus pneumoniae tigr4 at 1.99 a resolution
PDB Compounds: (A:) lipoate-protein ligase, putative

SCOP Domain Sequences for d1vqza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqza2 d.104.1.3 (A:1-241) LplA-like protein SP1160, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]}
mkyiinhsndtafnialeeyafkhlldedqifllwinkpsiivgrhqntieeinrdyvre
ngievvrrisgggavyhdlnnlnytiiskedenkafdfksfstpvintlaqlgvkaeftg
rndleidgkkfcgnaqayingrimhhgcllfdvdlsvlanalkvskdkfeskgvksvrar
vtniinelpkkitvekfrdllleymkkeypemteyvfseeelaeinrikdtkfgtwdwny
g

SCOP Domain Coordinates for d1vqza2:

Click to download the PDB-style file with coordinates for d1vqza2.
(The format of our PDB-style files is described here.)

Timeline for d1vqza2:

Domains from same chain:
(mouse over for more information)
d1vqza1