![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
![]() | Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) ![]() |
![]() | Family d.104.1.3: LplA-like [143642] (6 proteins) part of Pfam PF03099 |
![]() | Protein LplA-like protein SP1160, N-terminal domain [143645] (1 species) |
![]() | Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [143646] (1 PDB entry) Uniprot Q97QP1 1-241 |
![]() | Domain d1vqza2: 1vqz A:1-241 [120427] Other proteins in same PDB: d1vqza1, d1vqza3 complexed with edo, unl |
PDB Entry: 1vqz (more details), 1.99 Å
SCOPe Domain Sequences for d1vqza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vqza2 d.104.1.3 (A:1-241) LplA-like protein SP1160, N-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} mkyiinhsndtafnialeeyafkhlldedqifllwinkpsiivgrhqntieeinrdyvre ngievvrrisgggavyhdlnnlnytiiskedenkafdfksfstpvintlaqlgvkaeftg rndleidgkkfcgnaqayingrimhhgcllfdvdlsvlanalkvskdkfeskgvksvrar vtniinelpkkitvekfrdllleymkkeypemteyvfseeelaeinrikdtkfgtwdwny g
Timeline for d1vqza2: