SCOPe 2.08: Domain d1vqza2: 1vqz A:1-241

Lineage for d1vqza2 (1vqz A:1-241)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.3: LplA-like [143642] (6 proteins)
   part of Pfam PF03099

6. Protein LplA-like protein SP1160, N-terminal domain [143645] (1 species)

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [143646] (1 PDB entry)
   Uniprot Q97QP1 1-241

8. Domain d1vqza2: 1vqz A:1-241 [120427]
   Other proteins in same PDB: d1vqza1, d1vqza3
   complexed with edo, unl

Details for d1vqza2

PDB Entry: 1vqz, 1.99 Å

PDB Description: crystal structure of a putative lipoate-protein ligase a (sp_1160) from streptococcus pneumoniae tigr4 at 1.99 a resolution

PDB Compounds: (A:) lipoate-protein ligase, putative

SCOPe Domain Sequences for d1vqza2:

Sequence; same for both SEQRES and ATOM records:

>d1vqza2 d.104.1.3 (A:1-241) LplA-like protein SP1160, N-terminal domain {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mkyiinhsndtafnialeeyafkhlldedqifllwinkpsiivgrhqntieeinrdyvre
ngievvrrisgggavyhdlnnlnytiiskedenkafdfksfstpvintlaqlgvkaeftg
rndleidgkkfcgnaqayingrimhhgcllfdvdlsvlanalkvskdkfeskgvksvrar
vtniinelpkkitvekfrdllleymkkeypemteyvfseeelaeinrikdtkfgtwdwny
g

Timeline for d1vqza2:

• d1vqza2 first appeared in SCOP 1.73
  
• d1vqza2 appears in SCOPe 2.07