Lineage for d1vqza1 (1vqz A:242-329)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 740435Fold d.224: SufE/NifU [82648] (1 superfamily)
    alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123
  4. 740436Superfamily d.224.1: SufE/NifU [82649] (3 families) (S)
    iron-sulfur cluster assembly proteins
  5. 740459Family d.224.1.3: SP1160 C-terminal domain-like [143216] (1 protein)
  6. 740460Protein LplA-like protein SP1160, C-terminal domain [143217] (1 species)
  7. 740461Species Streptococcus pneumoniae [TaxId:1313] [143218] (1 PDB entry)
  8. 740462Domain d1vqza1: 1vqz A:242-329 [120426]
    Other proteins in same PDB: d1vqza2
    complexed with edo, unl

Details for d1vqza1

PDB Entry: 1vqz (more details), 1.99 Å

PDB Description: crystal structure of a putative lipoate-protein ligase a (sp_1160) from streptococcus pneumoniae tigr4 at 1.99 a resolution
PDB Compounds: (A:) lipoate-protein ligase, putative

SCOP Domain Sequences for d1vqza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqza1 d.224.1.3 (A:242-329) LplA-like protein SP1160, C-terminal domain {Streptococcus pneumoniae [TaxId: 1313]}
kspefnvrrgikftsgkvevfanvteskiqdikiygdffgiedvaavedvlrgvkyered
vlkalktiditryfagisreeiaeavvg

SCOP Domain Coordinates for d1vqza1:

Click to download the PDB-style file with coordinates for d1vqza1.
(The format of our PDB-style files is described here.)

Timeline for d1vqza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vqza2