Lineage for d1vqyh1 (1vqy H:1-104)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 861406Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (23 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 861592Family d.58.4.13: NIPSNAP [117943] (2 proteins)
    Pfam PF07978
  6. 861608Protein Hypothetical protein Atu5224 [143263] (1 species)
  7. 861609Species Agrobacterium tumefaciens [TaxId:358] [143264] (1 PDB entry)
    Uniprot Q8UK99 1-104
  8. 861617Domain d1vqyh1: 1vqy H:1-104 [120425]
    automatically matched to 1VQY A:1-104
    complexed with po4

Details for d1vqyh1

PDB Entry: 1vqy (more details), 2.4 Å

PDB Description: crystal structure of a nipsnap family protein (atu5224) from agrobacterium tumefaciens str. c58 at 2.40 a resolution
PDB Compounds: (H:) hypothetical protein AGR_pAT_315

SCOP Domain Sequences for d1vqyh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqyh1 d.58.4.13 (H:1-104) Hypothetical protein Atu5224 {Agrobacterium tumefaciens [TaxId: 358]}
miveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigplsqvihmwgyasl
ddraerrgklaedqrwqafiprlsvliessenrillptdfsplr

SCOP Domain Coordinates for d1vqyh1:

Click to download the PDB-style file with coordinates for d1vqyh1.
(The format of our PDB-style files is described here.)

Timeline for d1vqyh1: