Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.0: automated matches [191316] (1 protein) not a true family |
Protein automated matches [190081] (31 species) not a true protein |
Species Agrobacterium tumefaciens [TaxId:176299] [186802] (1 PDB entry) |
Domain d1vqyg2: 1vqy G:1-104 [120424] Other proteins in same PDB: d1vqya1, d1vqya2, d1vqyb3, d1vqyc3, d1vqyf3, d1vqyg3, d1vqyh3 automated match to d1vqsa_ complexed with po4 |
PDB Entry: 1vqy (more details), 2.4 Å
SCOPe Domain Sequences for d1vqyg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vqyg2 d.58.4.0 (G:1-104) automated matches {Agrobacterium tumefaciens [TaxId: 176299]} miveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigplsqvihmwgyasl ddraerrgklaedqrwqafiprlsvliessenrillptdfsplr
Timeline for d1vqyg2: