Lineage for d1vqyg2 (1vqy G:1-104)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2556580Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2557030Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 2557031Protein automated matches [190081] (31 species)
    not a true protein
  7. 2557037Species Agrobacterium tumefaciens [TaxId:176299] [186802] (1 PDB entry)
  8. 2557043Domain d1vqyg2: 1vqy G:1-104 [120424]
    Other proteins in same PDB: d1vqya1, d1vqya2, d1vqyb3, d1vqyc3, d1vqyf3, d1vqyg3, d1vqyh3
    automated match to d1vqsa_
    complexed with po4

Details for d1vqyg2

PDB Entry: 1vqy (more details), 2.4 Å

PDB Description: crystal structure of a nipsnap family protein (atu5224) from agrobacterium tumefaciens str. c58 at 2.40 a resolution
PDB Compounds: (G:) hypothetical protein AGR_pAT_315

SCOPe Domain Sequences for d1vqyg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqyg2 d.58.4.0 (G:1-104) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
miveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigplsqvihmwgyasl
ddraerrgklaedqrwqafiprlsvliessenrillptdfsplr

SCOPe Domain Coordinates for d1vqyg2:

Click to download the PDB-style file with coordinates for d1vqyg2.
(The format of our PDB-style files is described here.)

Timeline for d1vqyg2: