Lineage for d1vqyc_ (1vqy C:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1026927Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 1027247Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 1027248Protein automated matches [190081] (5 species)
    not a true protein
  7. 1027249Species Agrobacterium tumefaciens [TaxId:176299] [186802] (1 PDB entry)
  8. 1027251Domain d1vqyc_: 1vqy C: [120420]
    Other proteins in same PDB: d1vqya1
    automated match to d1vqsa_
    complexed with po4

Details for d1vqyc_

PDB Entry: 1vqy (more details), 2.4 Å

PDB Description: crystal structure of a nipsnap family protein (atu5224) from agrobacterium tumefaciens str. c58 at 2.40 a resolution
PDB Compounds: (C:) hypothetical protein AGR_pAT_315

SCOPe Domain Sequences for d1vqyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqyc_ d.58.4.0 (C:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
hmiveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigplsqvihmwgyas
lddraerrgklaedqrwqafiprlsvliessenrillptdfsplr

SCOPe Domain Coordinates for d1vqyc_:

Click to download the PDB-style file with coordinates for d1vqyc_.
(The format of our PDB-style files is described here.)

Timeline for d1vqyc_: