Lineage for d1vqpz1 (1vqp Z:10-82)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750692Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 751110Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (6 families) (S)
  5. 751111Family g.41.8.1: Ribosomal protein L37ae [57830] (1 protein)
  6. 751112Protein Ribosomal protein L37ae [57831] (1 species)
  7. 751113Species Archaeon Haloarcula marismortui [TaxId:2238] [57832] (40 PDB entries)
  8. 751130Domain d1vqpz1: 1vqp Z:10-82 [120416]
    Other proteins in same PDB: d1vqp11, d1vqp31, d1vqpa1, d1vqpa2, d1vqpb1, d1vqpc1, d1vqpd1, d1vqpe1, d1vqpe2, d1vqpf1, d1vqph1, d1vqpi1, d1vqpj1, d1vqpk1, d1vqpl1, d1vqpm1, d1vqpn1, d1vqpo1, d1vqpp1, d1vqpq1, d1vqpr1, d1vqps1, d1vqpt1, d1vqpu1, d1vqpv1, d1vqpw1, d1vqpx1, d1vqpy1
    automatically matched to d1s72z_
    complexed with 1ma, cd, cl, dcz, hfa, k, mg, na, omg, omu, po2, ppu, psu, sr, ur3

Details for d1vqpz1

PDB Entry: 1vqp (more details), 2.25 Å

PDB Description: The structure of the transition state analogue "RAP" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (Z:) 50S ribosomal protein L37Ae

SCOP Domain Sequences for d1vqpz1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqpz1 g.41.8.1 (Z:10-82) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]}
rsgrfgarygrvsrrrvaeiesemnedhacpncgedrvdrqgtgiwqcsycdykftggsy
kpetpggktvrrs

SCOP Domain Coordinates for d1vqpz1:

Click to download the PDB-style file with coordinates for d1vqpz1.
(The format of our PDB-style files is described here.)

Timeline for d1vqpz1: