Lineage for d1vqpx1 (1vqp X:7-88)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1200379Fold d.29: Ribosomal protein L31e [54574] (1 superfamily)
    beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342
  4. 1200380Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family) (S)
  5. 1200381Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein)
  6. 1200382Protein Ribosomal protein L31e [54577] (1 species)
  7. 1200383Species Haloarcula marismortui [TaxId:2238] [54578] (40 PDB entries)
    Uniprot P18138
  8. 1200386Domain d1vqpx1: 1vqp X:7-88 [120414]
    Other proteins in same PDB: d1vqp11, d1vqp21, d1vqp31, d1vqpa1, d1vqpa2, d1vqpb1, d1vqpc1, d1vqpd1, d1vqpe1, d1vqpe2, d1vqpf1, d1vqpg1, d1vqph1, d1vqpi1, d1vqpj1, d1vqpk1, d1vqpl1, d1vqpm1, d1vqpn1, d1vqpo1, d1vqpp1, d1vqpq1, d1vqpr1, d1vqps1, d1vqpt1, d1vqpu1, d1vqpv1, d1vqpw1, d1vqpy1, d1vqpz1
    automatically matched to d1ffku_
    protein/RNA complex; complexed with cd, cl, k, mg, na, sr

Details for d1vqpx1

PDB Entry: 1vqp (more details), 2.25 Å

PDB Description: The structure of the transition state analogue "RAP" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (X:) 50S ribosomal protein L31e

SCOPe Domain Sequences for d1vqpx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqpx1 d.29.1.1 (X:7-88) Ribosomal protein L31e {Haloarcula marismortui [TaxId: 2238]}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae

SCOPe Domain Coordinates for d1vqpx1:

Click to download the PDB-style file with coordinates for d1vqpx1.
(The format of our PDB-style files is described here.)

Timeline for d1vqpx1: