SCOPe 2.07: Domain d1vqpw1: 1vqp W:1-154

Lineage for d1vqpw1 (1vqp W:1-154)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
   core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold

4. Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family)

5. Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)

6. Protein Archaeal L30 (L30a) [55133] (1 species)
   long-chain member of the family; contains additional C-terminal (sub)domain

7. Species Haloarcula marismortui [TaxId:2238] [55134] (40 PDB entries)
   Uniprot P14121

8. Domain d1vqpw1: 1vqp W:1-154 [120413]
   Other proteins in same PDB: d1vqp11, d1vqp21, d1vqp31, d1vqpa1, d1vqpa2, d1vqpb1, d1vqpc1, d1vqpd1, d1vqpe1, d1vqpe2, d1vqpf1, d1vqpg1, d1vqph1, d1vqpi1, d1vqpj1, d1vqpk1, d1vqpl1, d1vqpm1, d1vqpn1, d1vqpo1, d1vqpp1, d1vqpq1, d1vqpr1, d1vqps1, d1vqpt1, d1vqpu1, d1vqpv1, d1vqpx1, d1vqpy1, d1vqpz1
   automatically matched to d1ffkt_
   protein/RNA complex; complexed with cd, cl, k, mg, na, sr

Details for d1vqpw1

PDB Entry: 1vqp, 2.25 Å

PDB Description: The structure of the transition state analogue "RAP" bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (W:) 50S ribosomal protein L30P

SCOPe Domain Sequences for d1vqpw1:

Sequence; same for both SEQRES and ATOM records:

>d1vqpw1 d.59.1.1 (W:1-154) Archaeal L30 (L30a) {Haloarcula marismortui [TaxId: 2238]}
mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe
tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp
prgghdgvkhpvkeggqlgkhdtegiddlleamr

Timeline for d1vqpw1:

• d1vqpw1 first appeared in SCOP 1.73
  
• d1vqpw1 appears in SCOPe 2.06
  
• d1vqpw1 appears in the current release, SCOPe 2.08