Lineage for d1vqpv1 (1vqp V:1-65)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2303207Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2303233Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) (S)
    automatically mapped to Pfam PF00831
  5. 2303234Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)
  6. 2303235Protein Ribosomal protein L29 (L29p) [46563] (5 species)
  7. 2303276Species Haloarcula marismortui [TaxId:2238] [46564] (40 PDB entries)
    Uniprot P10971
  8. 2303279Domain d1vqpv1: 1vqp V:1-65 [120412]
    Other proteins in same PDB: d1vqp11, d1vqp21, d1vqp31, d1vqpa1, d1vqpa2, d1vqpb1, d1vqpc1, d1vqpd1, d1vqpe1, d1vqpe2, d1vqpf1, d1vqpg1, d1vqph1, d1vqpi1, d1vqpj1, d1vqpk1, d1vqpl1, d1vqpm1, d1vqpn1, d1vqpo1, d1vqpp1, d1vqpq1, d1vqpr1, d1vqps1, d1vqpt1, d1vqpu1, d1vqpw1, d1vqpx1, d1vqpy1, d1vqpz1
    automatically matched to d1ffks_
    protein/RNA complex; complexed with cd, cl, k, mg, na, sr

Details for d1vqpv1

PDB Entry: 1vqp (more details), 2.25 Å

PDB Description: The structure of the transition state analogue "RAP" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (V:) 50S ribosomal protein L29P

SCOPe Domain Sequences for d1vqpv1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqpv1 a.2.2.1 (V:1-65) Ribosomal protein L29 (L29p) {Haloarcula marismortui [TaxId: 2238]}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

SCOPe Domain Coordinates for d1vqpv1:

Click to download the PDB-style file with coordinates for d1vqpv1.
(The format of our PDB-style files is described here.)

Timeline for d1vqpv1: