Lineage for d1vqpu1 (1vqp U:4-56)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640292Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2640293Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2640576Family g.39.1.6: Ribosomal protein L24e [57749] (1 protein)
    automatically mapped to Pfam PF01246
  6. 2640577Protein Ribosomal protein L24e [57750] (1 species)
  7. 2640578Species Haloarcula marismortui [TaxId:2238] [57751] (44 PDB entries)
    Uniprot P14116
  8. 2640581Domain d1vqpu1: 1vqp U:4-56 [120411]
    Other proteins in same PDB: d1vqp11, d1vqp21, d1vqp31, d1vqpa1, d1vqpa2, d1vqpb1, d1vqpc1, d1vqpd1, d1vqpe1, d1vqpe2, d1vqpf1, d1vqpg1, d1vqph1, d1vqpi1, d1vqpj1, d1vqpk1, d1vqpl1, d1vqpm1, d1vqpn1, d1vqpo1, d1vqpp1, d1vqpq1, d1vqpr1, d1vqps1, d1vqpt1, d1vqpv1, d1vqpw1, d1vqpx1, d1vqpy1, d1vqpz1
    automatically matched to d1ffkr_
    protein/RNA complex; complexed with cd, cl, k, mg, na, sr

Details for d1vqpu1

PDB Entry: 1vqp (more details), 2.25 Å

PDB Description: The structure of the transition state analogue "RAP" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (U:) 50S ribosomal protein L24e

SCOPe Domain Sequences for d1vqpu1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqpu1 g.39.1.6 (U:4-56) Ribosomal protein L24e {Haloarcula marismortui [TaxId: 2238]}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar

SCOPe Domain Coordinates for d1vqpu1:

Click to download the PDB-style file with coordinates for d1vqpu1.
(The format of our PDB-style files is described here.)

Timeline for d1vqpu1: