Class g: Small proteins [56992] (90 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) |
Family g.39.1.6: Ribosomal protein L24e [57749] (1 protein) |
Protein Ribosomal protein L24e [57750] (1 species) |
Species Haloarcula marismortui [TaxId:2238] [57751] (44 PDB entries) Uniprot P14116 |
Domain d1vqpu1: 1vqp U:4-56 [120411] Other proteins in same PDB: d1vqp11, d1vqp21, d1vqp31, d1vqpa1, d1vqpa2, d1vqpb1, d1vqpc1, d1vqpd1, d1vqpe1, d1vqpe2, d1vqpf1, d1vqpg1, d1vqph1, d1vqpi1, d1vqpj1, d1vqpk1, d1vqpl1, d1vqpm1, d1vqpn1, d1vqpo1, d1vqpp1, d1vqpq1, d1vqpr1, d1vqps1, d1vqpt1, d1vqpv1, d1vqpw1, d1vqpx1, d1vqpy1, d1vqpz1 automatically matched to d1ffkr_ protein/RNA complex; complexed with cd, cl, k, mg, na, sr |
PDB Entry: 1vqp (more details), 2.25 Å
SCOPe Domain Sequences for d1vqpu1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vqpu1 g.39.1.6 (U:4-56) Ribosomal protein L24e {Haloarcula marismortui [TaxId: 2238]} recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar
Timeline for d1vqpu1:
View in 3D Domains from other chains: (mouse over for more information) d1vqp11, d1vqp21, d1vqp31, d1vqpa1, d1vqpa2, d1vqpb1, d1vqpc1, d1vqpd1, d1vqpe1, d1vqpe2, d1vqpf1, d1vqpg1, d1vqph1, d1vqpi1, d1vqpj1, d1vqpk1, d1vqpl1, d1vqpm1, d1vqpn1, d1vqpo1, d1vqpp1, d1vqpq1, d1vqpr1, d1vqps1, d1vqpt1, d1vqpv1, d1vqpw1, d1vqpx1, d1vqpy1, d1vqpz1 |