SCOP 1.73: Domain d1vqpt1: 1vqp T:1-119

Lineage for d1vqpt1 (1vqp T:1-119)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.34: SH3-like barrel [50036] (18 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (6 families)
   many known members contain KOW motif

5. Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)

6. Protein Ribosomal proteins L24 (L24p) [50106] (2 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [50107] (44 PDB entries)

8. Domain d1vqpt1: 1vqp T:1-119 [120410]
   Other proteins in same PDB: d1vqp11, d1vqp31, d1vqpa1, d1vqpa2, d1vqpb1, d1vqpc1, d1vqpd1, d1vqpe1, d1vqpe2, d1vqpf1, d1vqph1, d1vqpi1, d1vqpj1, d1vqpk1, d1vqpl1, d1vqpm1, d1vqpn1, d1vqpo1, d1vqpp1, d1vqpq1, d1vqpr1, d1vqps1, d1vqpu1, d1vqpv1, d1vqpw1, d1vqpx1, d1vqpy1, d1vqpz1
   automatically matched to d1ffkq_
   complexed with 1ma, cd, cl, dcz, hfa, k, mg, na, omg, omu, po2, ppu, psu, sr, ur3

Details for d1vqpt1

PDB Entry: 1vqp, 2.25 Å

PDB Description: The structure of the transition state analogue "RAP" bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (T:) 50S ribosomal protein L24P

SCOP Domain Sequences for d1vqpt1:

Sequence; same for both SEQRES and ATOM records:

>d1vqpt1 b.34.5.1 (T:1-119) Ribosomal proteins L24 (L24p) {Archaeon Haloarcula marismortui [TaxId: 2238]}
skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa

Timeline for d1vqpt1:

• d1vqpt1 is new in SCOP 1.73
  
• d1vqpt1 appears in SCOP 1.75
  
• d1vqpt1 appears in the current release, SCOPe 2.08