Lineage for d1vqps1 (1vqp S:1-81)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 716450Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 716451Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) (S)
  5. 716452Family d.12.1.1: L23p [54190] (1 protein)
  6. 716453Protein Ribosomal protein L23 [54191] (2 species)
  7. 716454Species Archaeon Haloarcula marismortui [TaxId:2238] [54192] (44 PDB entries)
  8. 716471Domain d1vqps1: 1vqp S:1-81 [120409]
    Other proteins in same PDB: d1vqp11, d1vqp31, d1vqpa1, d1vqpa2, d1vqpb1, d1vqpc1, d1vqpd1, d1vqpe1, d1vqpe2, d1vqpf1, d1vqph1, d1vqpi1, d1vqpj1, d1vqpk1, d1vqpl1, d1vqpm1, d1vqpn1, d1vqpo1, d1vqpp1, d1vqpq1, d1vqpr1, d1vqpt1, d1vqpu1, d1vqpv1, d1vqpw1, d1vqpx1, d1vqpy1, d1vqpz1
    automatically matched to d1jj2r_
    complexed with 1ma, cd, cl, dcz, hfa, k, mg, na, omg, omu, po2, ppu, psu, sr, ur3

Details for d1vqps1

PDB Entry: 1vqp (more details), 2.25 Å

PDB Description: The structure of the transition state analogue "RAP" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (S:) 50S ribosomal protein L23P

SCOP Domain Sequences for d1vqps1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqps1 d.12.1.1 (S:1-81) Ribosomal protein L23 {Archaeon Haloarcula marismortui [TaxId: 2238]}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqevasri

SCOP Domain Coordinates for d1vqps1:

Click to download the PDB-style file with coordinates for d1vqps1.
(The format of our PDB-style files is described here.)

Timeline for d1vqps1: