SCOPe 2.04: Domain d1vqpq1: 1vqp Q:1-95

Lineage for d1vqpq1 (1vqp Q:1-95)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families)
   many known members contain KOW motif

5. Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)

6. Protein Ribosomal proteins L21e [50108] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [50109] (40 PDB entries)
   Uniprot P12734

8. Domain d1vqpq1: 1vqp Q:1-95 [120407]
   Other proteins in same PDB: d1vqp11, d1vqp21, d1vqp31, d1vqpa1, d1vqpa2, d1vqpb1, d1vqpc1, d1vqpd1, d1vqpe1, d1vqpe2, d1vqpf1, d1vqpg1, d1vqph1, d1vqpi1, d1vqpj1, d1vqpk1, d1vqpl1, d1vqpm1, d1vqpn1, d1vqpo1, d1vqpp1, d1vqpr1, d1vqps1, d1vqpt1, d1vqpu1, d1vqpv1, d1vqpw1, d1vqpx1, d1vqpy1, d1vqpz1
   automatically matched to d1ffkn_
   protein/RNA complex; complexed with cd, cl, k, mg, na, sr

Details for d1vqpq1

PDB Entry: 1vqp, 2.25 Å

PDB Description: The structure of the transition state analogue "RAP" bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (Q:) 50S ribosomal protein L21e

SCOPe Domain Sequences for d1vqpq1:

Sequence; same for both SEQRES and ATOM records:

>d1vqpq1 b.34.5.1 (Q:1-95) Ribosomal proteins L21e {Haloarcula marismortui [TaxId: 2238]}
pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt
gtvegkqgdaykvdivdggkektiivtaahlrrqe

Timeline for d1vqpq1:

• d1vqpq1 first appeared in SCOP 1.73
  
• d1vqpq1 appears in SCOPe 2.03
  
• d1vqpq1 appears in SCOPe 2.05
  
• d1vqpq1 appears in the current release, SCOPe 2.08