SCOP 1.73: Domain d1vqpp1: 1vqp P:1-143

Lineage for d1vqpp1 (1vqp P:1-143)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
   multihelical; consists of two different 3-helical domains connected by a long, partly helical linker

4. Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family)

5. Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)

6. Protein Ribosomal protein L19 (L19e) [48142] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [48143] (40 PDB entries)

8. Domain d1vqpp1: 1vqp P:1-143 [120406]
   Other proteins in same PDB: d1vqp11, d1vqp31, d1vqpa1, d1vqpa2, d1vqpb1, d1vqpc1, d1vqpd1, d1vqpe1, d1vqpe2, d1vqpf1, d1vqph1, d1vqpi1, d1vqpj1, d1vqpk1, d1vqpl1, d1vqpm1, d1vqpn1, d1vqpo1, d1vqpq1, d1vqpr1, d1vqps1, d1vqpt1, d1vqpu1, d1vqpv1, d1vqpw1, d1vqpx1, d1vqpy1, d1vqpz1
   automatically matched to d1s72p_
   complexed with 1ma, cd, cl, dcz, hfa, k, mg, na, omg, omu, po2, ppu, psu, sr, ur3

Details for d1vqpp1

PDB Entry: 1vqp, 2.25 Å

PDB Description: The structure of the transition state analogue "RAP" bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (P:) 50S ribosomal protein L19e

SCOP Domain Sequences for d1vqpp1:

Sequence; same for both SEQRES and ATOM records:

>d1vqpp1 a.94.1.1 (P:1-143) Ribosomal protein L19 (L19e) {Archaeon Haloarcula marismortui [TaxId: 2238]}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrayghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

Timeline for d1vqpp1:

• d1vqpp1 is new in SCOP 1.73
  
• d1vqpp1 appears in SCOP 1.75
  
• d1vqpp1 appears in the current release, SCOPe 2.08