Lineage for d1vqpo1 (1vqp O:1-115)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 824197Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
    core: three turns of irregular (beta-beta-alpha)n superhelix
  4. 824198Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) (S)
  5. 824199Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)
  6. 824291Protein Ribosomal protein L18e [52084] (1 species)
  7. 824292Species Archaeon Haloarcula marismortui [TaxId:2238] [52085] (40 PDB entries)
    Uniprot P12733
  8. 824295Domain d1vqpo1: 1vqp O:1-115 [120405]
    Other proteins in same PDB: d1vqp11, d1vqp21, d1vqp31, d1vqpa1, d1vqpa2, d1vqpb1, d1vqpc1, d1vqpd1, d1vqpe1, d1vqpe2, d1vqpf1, d1vqpg1, d1vqph1, d1vqpi1, d1vqpj1, d1vqpk1, d1vqpl1, d1vqpm1, d1vqpn1, d1vqpp1, d1vqpq1, d1vqpr1, d1vqps1, d1vqpt1, d1vqpu1, d1vqpv1, d1vqpw1, d1vqpx1, d1vqpy1, d1vqpz1
    automatically matched to d1ffkl_
    complexed with 1ma, cd, cl, dcz, hfa, k, mg, na, omg, omu, po2, ppu, psu, sr, ur3

Details for d1vqpo1

PDB Entry: 1vqp (more details), 2.25 Å

PDB Description: The structure of the transition state analogue "RAP" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (O:) 50S ribosomal protein L18e

SCOP Domain Sequences for d1vqpo1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqpo1 c.12.1.1 (O:1-115) Ribosomal protein L18e {Archaeon Haloarcula marismortui [TaxId: 2238]}
sktnprlssliadlksaarssggavwgdvaerlekprrthaevnlgrieryaqedetvvv
pgkvlgsgvlqkdvtvaavdfsgtaetkidqvgeavsleqaiennpegshvrvir

SCOP Domain Coordinates for d1vqpo1:

Click to download the PDB-style file with coordinates for d1vqpo1.
(The format of our PDB-style files is described here.)

Timeline for d1vqpo1: