Lineage for d1vqpk1 (1vqp K:1-132)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667238Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
    barrel, closed; n=5, S=8, meander
  4. 667239Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) (S)
  5. 667240Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)
  6. 667241Protein Ribosomal protein L14 [50195] (3 species)
  7. 667242Species Archaeon Haloarcula marismortui [TaxId:2238] [50197] (40 PDB entries)
  8. 667259Domain d1vqpk1: 1vqp K:1-132 [120401]
    Other proteins in same PDB: d1vqp11, d1vqp31, d1vqpa1, d1vqpa2, d1vqpb1, d1vqpc1, d1vqpd1, d1vqpe1, d1vqpe2, d1vqpf1, d1vqph1, d1vqpi1, d1vqpj1, d1vqpl1, d1vqpm1, d1vqpn1, d1vqpo1, d1vqpp1, d1vqpq1, d1vqpr1, d1vqps1, d1vqpt1, d1vqpu1, d1vqpv1, d1vqpw1, d1vqpx1, d1vqpy1, d1vqpz1
    automatically matched to d1s72k_
    complexed with 1ma, cd, cl, dcz, hfa, k, mg, na, omg, omu, po2, ppu, psu, sr, ur3

Details for d1vqpk1

PDB Entry: 1vqp (more details), 2.25 Å

PDB Description: The structure of the transition state analogue "RAP" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (K:) 50S ribosomal protein L14P

SCOP Domain Sequences for d1vqpk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqpk1 b.39.1.1 (K:1-132) Ribosomal protein L14 {Archaeon Haloarcula marismortui [TaxId: 2238]}
mealgadvtqglekgslitcadntgarelkvisvhgysgtknrlpkaglgdkitvsvtkg
tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
fgsvasaatmiv

SCOP Domain Coordinates for d1vqpk1:

Click to download the PDB-style file with coordinates for d1vqpk1.
(The format of our PDB-style files is described here.)

Timeline for d1vqpk1: