Lineage for d1vqpd1 (1vqp D:10-174)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2200932Fold d.77: RL5-like [55281] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654
  4. 2200933Superfamily d.77.1: RL5-like [55282] (3 families) (S)
  5. 2200934Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein)
  6. 2200935Protein Ribosomal protein L5 [55284] (5 species)
    synonym: 50S ribosomal protein L5p, HMAL5, HL13
  7. 2200976Species Haloarcula marismortui [TaxId:2238] [55285] (40 PDB entries)
    Uniprot P14124
  8. 2200979Domain d1vqpd1: 1vqp D:10-174 [120394]
    Other proteins in same PDB: d1vqp11, d1vqp21, d1vqp31, d1vqpa1, d1vqpa2, d1vqpb1, d1vqpc1, d1vqpe1, d1vqpe2, d1vqpf1, d1vqpg1, d1vqph1, d1vqpi1, d1vqpj1, d1vqpk1, d1vqpl1, d1vqpm1, d1vqpn1, d1vqpo1, d1vqpp1, d1vqpq1, d1vqpr1, d1vqps1, d1vqpt1, d1vqpu1, d1vqpv1, d1vqpw1, d1vqpx1, d1vqpy1, d1vqpz1
    automatically matched to d1ffkd_
    protein/RNA complex; complexed with cd, cl, k, mg, na, sr

Details for d1vqpd1

PDB Entry: 1vqp (more details), 2.25 Å

PDB Description: The structure of the transition state analogue "RAP" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (D:) 50S ribosomal protein L5P

SCOPe Domain Sequences for d1vqpd1:

Sequence, based on SEQRES records: (download)

>d1vqpd1 d.77.1.1 (D:10-174) Ribosomal protein L5 {Haloarcula marismortui [TaxId: 2238]}
fhemrepriekvvvhmgighggrdlanaedilgeitgqmpvrtkakrtvgefdiregdpi
gakvtlrdemaeeflqtalplaelatsqfddtgnfsfgveehtefpsqeydpsigiygld
vtvnlvrpgyrvakrdkasrsiptkhrlnpadavafiestydvev

Sequence, based on observed residues (ATOM records): (download)

>d1vqpd1 d.77.1.1 (D:10-174) Ribosomal protein L5 {Haloarcula marismortui [TaxId: 2238]}
fhemrepriekvvvhmgighanaedilgeitgqmpvrtkakrtvgefdiregdpigakvt
lrdemaeeflqtalplaelatsqfddtgnfsfgldvtvnlvrpgyrvakrdkasrsiptk
hrlnpadavafiestydvev

SCOPe Domain Coordinates for d1vqpd1:

Click to download the PDB-style file with coordinates for d1vqpd1.
(The format of our PDB-style files is described here.)

Timeline for d1vqpd1: