Class b: All beta proteins [48724] (174 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.5: Translation proteins SH3-like domain [50104] (7 families) many known members contain KOW motif |
Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein) |
Protein C-terminal domain of ribosomal protein L2 [50115] (5 species) |
Species Archaeon Haloarcula marismortui [TaxId:2238] [50117] (40 PDB entries) Uniprot P20276 |
Domain d1vqpa1: 1vqp A:91-237 [120390] Other proteins in same PDB: d1vqp11, d1vqp21, d1vqp31, d1vqpa2, d1vqpb1, d1vqpc1, d1vqpd1, d1vqpe1, d1vqpe2, d1vqpf1, d1vqpg1, d1vqph1, d1vqpi1, d1vqpj1, d1vqpk1, d1vqpl1, d1vqpm1, d1vqpn1, d1vqpo1, d1vqpp1, d1vqpq1, d1vqpr1, d1vqps1, d1vqpt1, d1vqpu1, d1vqpv1, d1vqpw1, d1vqpx1, d1vqpy1, d1vqpz1 automatically matched to d1s72a1 complexed with 1ma, cd, cl, dcz, hfa, k, mg, na, omg, omu, po2, ppu, psu, sr, ur3 |
PDB Entry: 1vqp (more details), 2.25 Å
SCOP Domain Sequences for d1vqpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vqpa1 b.34.5.3 (A:91-237) C-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui [TaxId: 2238]} gntlplaeipegvpvcnvesspgdggkfarasgvnaqllthdrnvavvklpsgemkrldp qcratigvvagggrtdkpfvkagnkhhkmkargtkwpnvrgvamnavdhpfggggrqhpg kpksisrnappgrkvgdiaskrtgrgg
Timeline for d1vqpa1:
View in 3D Domains from other chains: (mouse over for more information) d1vqp11, d1vqp21, d1vqp31, d1vqpb1, d1vqpc1, d1vqpd1, d1vqpe1, d1vqpe2, d1vqpf1, d1vqpg1, d1vqph1, d1vqpi1, d1vqpj1, d1vqpk1, d1vqpl1, d1vqpm1, d1vqpn1, d1vqpo1, d1vqpp1, d1vqpq1, d1vqpr1, d1vqps1, d1vqpt1, d1vqpu1, d1vqpv1, d1vqpw1, d1vqpx1, d1vqpy1, d1vqpz1 |