Lineage for d1vqp31 (1vqp 3:1-92)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1705786Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1706394Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 1706499Family g.41.8.3: Ribosomal protein L44e [57836] (1 protein)
    automatically mapped to Pfam PF00935
  6. 1706500Protein Ribosomal protein L44e [57837] (1 species)
  7. 1706501Species Haloarcula marismortui [TaxId:2238] [57838] (40 PDB entries)
    Uniprot P32411
  8. 1706504Domain d1vqp31: 1vqp 3:1-92 [120389]
    Other proteins in same PDB: d1vqp11, d1vqp21, d1vqpa1, d1vqpa2, d1vqpb1, d1vqpc1, d1vqpd1, d1vqpe1, d1vqpe2, d1vqpf1, d1vqpg1, d1vqph1, d1vqpi1, d1vqpj1, d1vqpk1, d1vqpl1, d1vqpm1, d1vqpn1, d1vqpo1, d1vqpp1, d1vqpq1, d1vqpr1, d1vqps1, d1vqpt1, d1vqpu1, d1vqpv1, d1vqpw1, d1vqpx1, d1vqpy1, d1vqpz1
    automatically matched to d1ffkz_
    protein/RNA complex; complexed with cd, cl, k, mg, na, sr

Details for d1vqp31

PDB Entry: 1vqp (more details), 2.25 Å

PDB Description: The structure of the transition state analogue "RAP" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (3:) 50S ribosomal protein L44E

SCOPe Domain Sequences for d1vqp31:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqp31 g.41.8.3 (3:1-92) Ribosomal protein L44e {Haloarcula marismortui [TaxId: 2238]}
mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
ptkktdlkyrcgecgkahlregwragrlefqe

SCOPe Domain Coordinates for d1vqp31:

Click to download the PDB-style file with coordinates for d1vqp31.
(The format of our PDB-style files is described here.)

Timeline for d1vqp31: