SCOP 1.75: Domain d1vqp31: 1vqp 3:1-92

Lineage for d1vqp31 (1vqp 3:1-92)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families)

5. Family g.41.8.3: Ribosomal protein L44e [57836] (1 protein)

6. Protein Ribosomal protein L44e [57837] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [57838] (40 PDB entries)
   Uniprot P32411

8. Domain d1vqp31: 1vqp 3:1-92 [120389]
   Other proteins in same PDB: d1vqp11, d1vqp21, d1vqpa1, d1vqpa2, d1vqpb1, d1vqpc1, d1vqpd1, d1vqpe1, d1vqpe2, d1vqpf1, d1vqpg1, d1vqph1, d1vqpi1, d1vqpj1, d1vqpk1, d1vqpl1, d1vqpm1, d1vqpn1, d1vqpo1, d1vqpp1, d1vqpq1, d1vqpr1, d1vqps1, d1vqpt1, d1vqpu1, d1vqpv1, d1vqpw1, d1vqpx1, d1vqpy1, d1vqpz1
   automatically matched to d1ffkz_
   complexed with 1ma, cd, cl, dcz, hfa, k, mg, na, omg, omu, po2, ppu, psu, sr, ur3

Details for d1vqp31

PDB Entry: 1vqp, 2.25 Å

PDB Description: The structure of the transition state analogue "RAP" bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (3:) 50S ribosomal protein L44E

SCOP Domain Sequences for d1vqp31:

Sequence; same for both SEQRES and ATOM records:

>d1vqp31 g.41.8.3 (3:1-92) Ribosomal protein L44e {Archaeon Haloarcula marismortui [TaxId: 2238]}
mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
ptkktdlkyrcgecgkahlregwragrlefqe

Timeline for d1vqp31:

• d1vqp31 first appeared in SCOP 1.73
  
• d1vqp31 appears in SCOPe 2.01
  
• d1vqp31 appears in the current release, SCOPe 2.08