Lineage for d1vqp11 (1vqp 1:1-56)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1464002Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1464553Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) (S)
  5. 1464615Family g.41.8.2: Ribosomal protein L37e [57833] (1 protein)
    automatically mapped to Pfam PF01907
  6. 1464616Protein Ribosomal protein L37e [57834] (1 species)
  7. 1464617Species Haloarcula marismortui [TaxId:2238] [57835] (40 PDB entries)
    Uniprot P32410
  8. 1464620Domain d1vqp11: 1vqp 1:1-56 [120388]
    Other proteins in same PDB: d1vqp21, d1vqp31, d1vqpa1, d1vqpa2, d1vqpb1, d1vqpc1, d1vqpd1, d1vqpe1, d1vqpe2, d1vqpf1, d1vqpg1, d1vqph1, d1vqpi1, d1vqpj1, d1vqpk1, d1vqpl1, d1vqpm1, d1vqpn1, d1vqpo1, d1vqpp1, d1vqpq1, d1vqpr1, d1vqps1, d1vqpt1, d1vqpu1, d1vqpv1, d1vqpw1, d1vqpx1, d1vqpy1, d1vqpz1
    automatically matched to d1ffkx_
    protein/RNA complex; complexed with cd, cl, k, mg, na, sr

Details for d1vqp11

PDB Entry: 1vqp (more details), 2.25 Å

PDB Description: The structure of the transition state analogue "RAP" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (1:) 50S ribosomal protein L37e

SCOPe Domain Sequences for d1vqp11:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqp11 g.41.8.2 (1:1-56) Ribosomal protein L37e {Haloarcula marismortui [TaxId: 2238]}
tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage

SCOPe Domain Coordinates for d1vqp11:

Click to download the PDB-style file with coordinates for d1vqp11.
(The format of our PDB-style files is described here.)

Timeline for d1vqp11: