Lineage for d1vqox1 (1vqo X:7-88)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720856Fold d.29: Ribosomal protein L31e [54574] (1 superfamily)
    beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342
  4. 720857Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family) (S)
  5. 720858Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein)
  6. 720859Protein Ribosomal protein L31e [54577] (1 species)
  7. 720860Species Archaeon Haloarcula marismortui [TaxId:2238] [54578] (40 PDB entries)
  8. 720872Domain d1vqox1: 1vqo X:7-88 [120385]
    Other proteins in same PDB: d1vqo11, d1vqo31, d1vqoa1, d1vqoa2, d1vqob1, d1vqoc1, d1vqod1, d1vqoe1, d1vqoe2, d1vqof1, d1vqoh1, d1vqoi1, d1vqoj1, d1vqok1, d1vqol1, d1vqom1, d1vqon1, d1vqoo1, d1vqop1, d1vqoq1, d1vqor1, d1vqos1, d1vqot1, d1vqou1, d1vqov1, d1vqow1, d1vqoy1, d1vqoz1
    automatically matched to d1ffku_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, ppu, psu, sr, ur3

Details for d1vqox1

PDB Entry: 1vqo (more details), 2.2 Å

PDB Description: The structure of CCPMN bound to the large ribosomal subunit haloarcula marismortui
PDB Compounds: (X:) 50S ribosomal protein L31e

SCOP Domain Sequences for d1vqox1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqox1 d.29.1.1 (X:7-88) Ribosomal protein L31e {Archaeon Haloarcula marismortui [TaxId: 2238]}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae

SCOP Domain Coordinates for d1vqox1:

Click to download the PDB-style file with coordinates for d1vqox1.
(The format of our PDB-style files is described here.)

Timeline for d1vqox1: