Lineage for d1vqov1 (1vqo V:1-65)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 760084Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 760101Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) (S)
  5. 760102Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)
  6. 760103Protein Ribosomal protein L29 (L29p) [46563] (5 species)
  7. 760104Species Archaeon Haloarcula marismortui [TaxId:2238] [46564] (44 PDB entries)
    Uniprot P10971
  8. 760105Domain d1vqov1: 1vqo V:1-65 [120383]
    Other proteins in same PDB: d1vqo11, d1vqo21, d1vqo31, d1vqoa1, d1vqoa2, d1vqob1, d1vqoc1, d1vqod1, d1vqoe1, d1vqoe2, d1vqof1, d1vqog1, d1vqoh1, d1vqoi1, d1vqoj1, d1vqok1, d1vqol1, d1vqom1, d1vqon1, d1vqoo1, d1vqop1, d1vqoq1, d1vqor1, d1vqos1, d1vqot1, d1vqou1, d1vqow1, d1vqox1, d1vqoy1, d1vqoz1
    automatically matched to d1ffks_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, ppu, psu, sr, ur3

Details for d1vqov1

PDB Entry: 1vqo (more details), 2.2 Å

PDB Description: The structure of CCPMN bound to the large ribosomal subunit haloarcula marismortui
PDB Compounds: (V:) 50S ribosomal protein L29P

SCOP Domain Sequences for d1vqov1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqov1 a.2.2.1 (V:1-65) Ribosomal protein L29 (L29p) {Archaeon Haloarcula marismortui [TaxId: 2238]}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

SCOP Domain Coordinates for d1vqov1:

Click to download the PDB-style file with coordinates for d1vqov1.
(The format of our PDB-style files is described here.)

Timeline for d1vqov1: