Lineage for d1vqop1 (1vqo P:1-143)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1742039Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
    multihelical; consists of two different 3-helical domains connected by a long, partly helical linker
  4. 1742040Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) (S)
    automatically mapped to Pfam PF01280
  5. 1742041Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)
  6. 1742042Protein Ribosomal protein L19 (L19e) [48142] (1 species)
  7. 1742043Species Haloarcula marismortui [TaxId:2238] [48143] (58 PDB entries)
    Uniprot P14119
  8. 1742045Domain d1vqop1: 1vqo P:1-143 [120377]
    Other proteins in same PDB: d1vqo11, d1vqo21, d1vqo31, d1vqoa1, d1vqoa2, d1vqob1, d1vqoc1, d1vqod1, d1vqoe1, d1vqoe2, d1vqof1, d1vqog1, d1vqoh1, d1vqoi1, d1vqoj1, d1vqok1, d1vqol1, d1vqom1, d1vqon1, d1vqoo1, d1vqoq1, d1vqor1, d1vqos1, d1vqot1, d1vqou1, d1vqov1, d1vqow1, d1vqox1, d1vqoy1, d1vqoz1
    automatically matched to d1s72p_
    protein/RNA complex; complexed with cd, cl, k, mg, na, sr

Details for d1vqop1

PDB Entry: 1vqo (more details), 2.2 Å

PDB Description: The structure of CCPMN bound to the large ribosomal subunit haloarcula marismortui
PDB Compounds: (P:) 50S ribosomal protein L19e

SCOPe Domain Sequences for d1vqop1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqop1 a.94.1.1 (P:1-143) Ribosomal protein L19 (L19e) {Haloarcula marismortui [TaxId: 2238]}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrayghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

SCOPe Domain Coordinates for d1vqop1:

Click to download the PDB-style file with coordinates for d1vqop1.
(The format of our PDB-style files is described here.)

Timeline for d1vqop1: