SCOPe 2.07: Domain d1vqom1: 1vqo M:1-194

Lineage for d1vqom1 (1vqo M:1-194)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
   beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243

4. Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families)

5. Family d.12.1.2: L15e [54193] (1 protein)
   elaborated with additional structures
   automatically mapped to Pfam PF00827

6. Protein Ribosomal protein L15e [54194] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [54195] (42 PDB entries)
   Uniprot P60618

8. Domain d1vqom1: 1vqo M:1-194 [120374]
   Other proteins in same PDB: d1vqo11, d1vqo21, d1vqo31, d1vqoa1, d1vqoa2, d1vqob1, d1vqoc1, d1vqod1, d1vqoe1, d1vqoe2, d1vqof1, d1vqog1, d1vqoh1, d1vqoi1, d1vqoj1, d1vqok1, d1vqol1, d1vqon1, d1vqoo1, d1vqop1, d1vqoq1, d1vqor1, d1vqos1, d1vqot1, d1vqou1, d1vqov1, d1vqow1, d1vqox1, d1vqoy1, d1vqoz1
   automatically matched to d1s72m_
   protein/RNA complex; complexed with cd, cl, k, mg, na, sr

Details for d1vqom1

PDB Entry: 1vqo, 2.2 Å

PDB Description: The structure of CCPMN bound to the large ribosomal subunit haloarcula marismortui

PDB Compounds: (M:) 50S ribosomal protein L15e

SCOPe Domain Sequences for d1vqom1:

Sequence; same for both SEQRES and ATOM records:

>d1vqom1 d.12.1.2 (M:1-194) Ribosomal protein L15e {Haloarcula marismortui [TaxId: 2238]}
arsaysyirdawenpgdgqlaelqwqrqqewrnegaverierptrldkarsqgykakqgv
ivarvsvrkgsarkrrhkagrrskrqgvtritrrkdiqrvaeerasrtfpnlrvlnsysv
gqdgrqkwhevilidpnhpaiqndddlswicaddqadrvfrgltgagrrnrglsgkgkgs
ektrpslrsnggka

Timeline for d1vqom1:

• d1vqom1 first appeared in SCOP 1.73
  
• d1vqom1 appears in SCOPe 2.06
  
• d1vqom1 appears in the current release, SCOPe 2.08