SCOP 1.73: Domain d1vqok1: 1vqo K:1-132

Lineage for d1vqok1 (1vqo K:1-132)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
   barrel, closed; n=5, S=8, meander

4. Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family)

5. Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)

6. Protein Ribosomal protein L14 [50195] (3 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [50197] (40 PDB entries)

8. Domain d1vqok1: 1vqo K:1-132 [120372]
   Other proteins in same PDB: d1vqo11, d1vqo31, d1vqoa1, d1vqoa2, d1vqob1, d1vqoc1, d1vqod1, d1vqoe1, d1vqoe2, d1vqof1, d1vqoh1, d1vqoi1, d1vqoj1, d1vqol1, d1vqom1, d1vqon1, d1vqoo1, d1vqop1, d1vqoq1, d1vqor1, d1vqos1, d1vqot1, d1vqou1, d1vqov1, d1vqow1, d1vqox1, d1vqoy1, d1vqoz1
   automatically matched to d1s72k_
   complexed with 1ma, cd, cl, k, mg, na, omg, omu, ppu, psu, sr, ur3

Details for d1vqok1

PDB Entry: 1vqo, 2.2 Å

PDB Description: The structure of CCPMN bound to the large ribosomal subunit haloarcula marismortui

PDB Compounds: (K:) 50S ribosomal protein L14P

SCOP Domain Sequences for d1vqok1:

Sequence; same for both SEQRES and ATOM records:

>d1vqok1 b.39.1.1 (K:1-132) Ribosomal protein L14 {Archaeon Haloarcula marismortui [TaxId: 2238]}
mealgadvtqglekgslitcadntgarelkvisvhgysgtknrlpkaglgdkitvsvtkg
tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
fgsvasaatmiv

Timeline for d1vqok1:

• d1vqok1 is new in SCOP 1.73
  
• d1vqok1 appears in SCOP 1.75
  
• d1vqok1 appears in the current release, SCOPe 2.08