SCOP 1.73: Domain d1vqoj1: 1vqo J:4-145

Lineage for d1vqoj1 (1vqo J:4-145)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.21: Ribosomal protein L13 [52160] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family)

5. Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein)

6. Protein Ribosomal protein L13 [52163] (2 species)
   synonym: 50S ribosomal protein L13p, HMAL13

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [52164] (44 PDB entries)

8. Domain d1vqoj1: 1vqo J:4-145 [120371]
   Other proteins in same PDB: d1vqo11, d1vqo31, d1vqoa1, d1vqoa2, d1vqob1, d1vqoc1, d1vqod1, d1vqoe1, d1vqoe2, d1vqof1, d1vqoh1, d1vqoi1, d1vqok1, d1vqol1, d1vqom1, d1vqon1, d1vqoo1, d1vqop1, d1vqoq1, d1vqor1, d1vqos1, d1vqot1, d1vqou1, d1vqov1, d1vqow1, d1vqox1, d1vqoy1, d1vqoz1
   automatically matched to d1ffkg_
   complexed with 1ma, cd, cl, k, mg, na, omg, omu, ppu, psu, sr, ur3

Details for d1vqoj1

PDB Entry: 1vqo, 2.2 Å

PDB Description: The structure of CCPMN bound to the large ribosomal subunit haloarcula marismortui

PDB Compounds: (J:) 50S ribosomal protein L13P

SCOP Domain Sequences for d1vqoj1:

Sequence; same for both SEQRES and ATOM records:

>d1vqoj1 c.21.1.1 (J:4-145) Ribosomal protein L13 {Archaeon Haloarcula marismortui [TaxId: 2238]}
aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr
lsnikfvtlgeisetlganktw

Timeline for d1vqoj1:

• d1vqoj1 is new in SCOP 1.73
  
• d1vqoj1 appears in SCOP 1.75
  
• d1vqoj1 appears in the current release, SCOPe 2.08