![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.21: Ribosomal protein L13 [52160] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214 |
![]() | Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) ![]() |
![]() | Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein) |
![]() | Protein Ribosomal protein L13 [52163] (2 species) synonym: 50S ribosomal protein L13p, HMAL13 |
![]() | Species Archaeon Haloarcula marismortui [TaxId:2238] [52164] (44 PDB entries) |
![]() | Domain d1vqoj1: 1vqo J:4-145 [120371] Other proteins in same PDB: d1vqo11, d1vqo31, d1vqoa1, d1vqoa2, d1vqob1, d1vqoc1, d1vqod1, d1vqoe1, d1vqoe2, d1vqof1, d1vqoh1, d1vqoi1, d1vqok1, d1vqol1, d1vqom1, d1vqon1, d1vqoo1, d1vqop1, d1vqoq1, d1vqor1, d1vqos1, d1vqot1, d1vqou1, d1vqov1, d1vqow1, d1vqox1, d1vqoy1, d1vqoz1 automatically matched to d1ffkg_ complexed with 1ma, cd, cl, k, mg, na, omg, omu, ppu, psu, sr, ur3 |
PDB Entry: 1vqo (more details), 2.2 Å
SCOP Domain Sequences for d1vqoj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vqoj1 c.21.1.1 (J:4-145) Ribosomal protein L13 {Archaeon Haloarcula marismortui [TaxId: 2238]} aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr lsnikfvtlgeisetlganktw
Timeline for d1vqoj1:
![]() Domains from other chains: (mouse over for more information) d1vqo11, d1vqo31, d1vqoa1, d1vqoa2, d1vqob1, d1vqoc1, d1vqod1, d1vqoe1, d1vqoe2, d1vqof1, d1vqoh1, d1vqoi1, d1vqok1, d1vqol1, d1vqom1, d1vqon1, d1vqoo1, d1vqop1, d1vqoq1, d1vqor1, d1vqos1, d1vqot1, d1vqou1, d1vqov1, d1vqow1, d1vqox1, d1vqoy1, d1vqoz1 |