Lineage for d1vqoi1 (1vqo I:71-140)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 634286Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 636030Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 636031Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 636032Protein Ribosomal protein L11, C-terminal domain [46908] (3 species)
  7. 636033Species Archaeon Haloarcula marismortui [TaxId:2238] [109705] (22 PDB entries)
  8. 636041Domain d1vqoi1: 1vqo I:71-140 [120370]
    Other proteins in same PDB: d1vqo11, d1vqo31, d1vqoa1, d1vqoa2, d1vqob1, d1vqoc1, d1vqod1, d1vqoe1, d1vqoe2, d1vqof1, d1vqoh1, d1vqoj1, d1vqok1, d1vqol1, d1vqom1, d1vqon1, d1vqoo1, d1vqop1, d1vqoq1, d1vqor1, d1vqos1, d1vqot1, d1vqou1, d1vqov1, d1vqow1, d1vqox1, d1vqoy1, d1vqoz1
    automatically matched to d1s72i_
    complexed with 1ma, cd, cl, k, mg, na, omg, omu, ppu, psu, sr, ur3

Details for d1vqoi1

PDB Entry: 1vqo (more details), 2.2 Å

PDB Description: The structure of CCPMN bound to the large ribosomal subunit haloarcula marismortui
PDB Compounds: (I:) 50S ribosomal protein L11P

SCOP Domain Sequences for d1vqoi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqoi1 a.4.7.1 (I:71-140) Ribosomal protein L11, C-terminal domain {Archaeon Haloarcula marismortui [TaxId: 2238]}
gvpptaelikdeagfetgsgepqedfvadlsvdqvkqiaeqkhpdllsydltnaakevvg
tctslgvtie

SCOP Domain Coordinates for d1vqoi1:

Click to download the PDB-style file with coordinates for d1vqoi1.
(The format of our PDB-style files is described here.)

Timeline for d1vqoi1: