| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families) ![]() |
| Family d.41.4.1: Ribosomal protein L10e [54687] (1 protein) |
| Protein Ribosomal protein L10e [54688] (2 species) |
| Species Haloarcula marismortui [TaxId:2238] [54689] (58 PDB entries) Uniprot P60617 |
| Domain d1vqoh1: 1vqo H:1-163 [120369] Other proteins in same PDB: d1vqo11, d1vqo21, d1vqo31, d1vqoa1, d1vqoa2, d1vqob1, d1vqoc1, d1vqod1, d1vqoe1, d1vqoe2, d1vqof1, d1vqog1, d1vqoi1, d1vqoj1, d1vqok1, d1vqol1, d1vqom1, d1vqon1, d1vqoo1, d1vqop1, d1vqoq1, d1vqor1, d1vqos1, d1vqot1, d1vqou1, d1vqov1, d1vqow1, d1vqox1, d1vqoy1, d1vqoz1 automatically matched to d1s72h_ protein/RNA complex; complexed with cd, cl, k, mg, na, sr |
PDB Entry: 1vqo (more details), 2.2 Å
SCOPe Domain Sequences for d1vqoh1:
Sequence, based on SEQRES records: (download)
>d1vqoh1 d.41.4.1 (H:1-163) Ribosomal protein L10e {Haloarcula marismortui [TaxId: 2238]}
kpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvqlrhg
sleasrlsanrhlikelgeegdykmtlrkfphqvlrenkqatgagadrvsdgmraafgki
vgtaarvqageqlftaycnvedaehvkeafrraynkitpscri
>d1vqoh1 d.41.4.1 (H:1-163) Ribosomal protein L10e {Haloarcula marismortui [TaxId: 2238]}
kpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvqlrhg
sleasrlsanrhlikelgeegdykmtlrkfphqvlrenkdgmraafgkivgtaarvqage
qlftaycnvedaehvkeafrraynkitpscri
Timeline for d1vqoh1:
View in 3DDomains from other chains: (mouse over for more information) d1vqo11, d1vqo21, d1vqo31, d1vqoa1, d1vqoa2, d1vqob1, d1vqoc1, d1vqod1, d1vqoe1, d1vqoe2, d1vqof1, d1vqog1, d1vqoi1, d1vqoj1, d1vqok1, d1vqol1, d1vqom1, d1vqon1, d1vqoo1, d1vqop1, d1vqoq1, d1vqor1, d1vqos1, d1vqot1, d1vqou1, d1vqov1, d1vqow1, d1vqox1, d1vqoy1, d1vqoz1 |