Lineage for d1vqoe1 (1vqo E:1-79)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1432788Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 1432789Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
    automatically mapped to Pfam PF00347
  5. 1432790Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 1432791Protein Ribosomal protein L6 [56055] (6 species)
    duplication: consists of two domains of this fold
  7. 1432863Species Haloarcula marismortui [TaxId:2238] [56057] (40 PDB entries)
    Uniprot P14135
  8. 1432866Domain d1vqoe1: 1vqo E:1-79 [120366]
    Other proteins in same PDB: d1vqo11, d1vqo21, d1vqo31, d1vqoa1, d1vqoa2, d1vqob1, d1vqoc1, d1vqod1, d1vqof1, d1vqog1, d1vqoh1, d1vqoi1, d1vqoj1, d1vqok1, d1vqol1, d1vqom1, d1vqon1, d1vqoo1, d1vqop1, d1vqoq1, d1vqor1, d1vqos1, d1vqot1, d1vqou1, d1vqov1, d1vqow1, d1vqox1, d1vqoy1, d1vqoz1
    automatically matched to d1ffk11
    protein/RNA complex; complexed with cd, cl, k, mg, na, sr

Details for d1vqoe1

PDB Entry: 1vqo (more details), 2.2 Å

PDB Description: The structure of CCPMN bound to the large ribosomal subunit haloarcula marismortui
PDB Compounds: (E:) 50S ribosomal protein L6P

SCOPe Domain Sequences for d1vqoe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqoe1 d.141.1.1 (E:1-79) Ribosomal protein L6 {Haloarcula marismortui [TaxId: 2238]}
prveleipedvdaeqdhlditvegdngsvtrrlwypdidvsvdgdtvviesdednaktms
tigtfqshienmfhgvteg

SCOPe Domain Coordinates for d1vqoe1:

Click to download the PDB-style file with coordinates for d1vqoe1.
(The format of our PDB-style files is described here.)

Timeline for d1vqoe1: