Lineage for d1vqob1 (1vqo B:1-337)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2402482Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2402557Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2402736Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein)
    automatically mapped to Pfam PF00297
  6. 2402737Protein Ribosomal protein L3 [50462] (4 species)
    superfamily fold is elaborated with additional structures
  7. 2402778Species Haloarcula marismortui [TaxId:2238] [50463] (58 PDB entries)
    Uniprot P20279
  8. 2402780Domain d1vqob1: 1vqo B:1-337 [120363]
    Other proteins in same PDB: d1vqo11, d1vqo21, d1vqo31, d1vqoa1, d1vqoa2, d1vqoc1, d1vqod1, d1vqoe1, d1vqoe2, d1vqof1, d1vqog1, d1vqoh1, d1vqoi1, d1vqoj1, d1vqok1, d1vqol1, d1vqom1, d1vqon1, d1vqoo1, d1vqop1, d1vqoq1, d1vqor1, d1vqos1, d1vqot1, d1vqou1, d1vqov1, d1vqow1, d1vqox1, d1vqoy1, d1vqoz1
    automatically matched to d1jj2b_
    protein/RNA complex; complexed with cd, cl, k, mg, na, sr

Details for d1vqob1

PDB Entry: 1vqo (more details), 2.2 Å

PDB Description: The structure of CCPMN bound to the large ribosomal subunit haloarcula marismortui
PDB Compounds: (B:) 50S ribosomal protein L3P

SCOPe Domain Sequences for d1vqob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqob1 b.43.3.2 (B:1-337) Ribosomal protein L3 {Haloarcula marismortui [TaxId: 2238]}
pqpsrprkgslgfgprkrstsetprfnswpsddgqpgvqgfagykagmthvvlvndepns
pregmeetvpvtvietppmravalrayedtpygqrpltevwtdefhseldrtldvpedhd
pdaaeeqirdaheagdlgdlrlithtvpdavpsvpkkkpdvmetrvgggsvsdrldhald
ivedggehamndifrageyadvagvtkgkgtqgpvkrwgvqkrkgkharqgwrrrignlg
pwnpsrvrstvpqqgqtgyhqrtelnkrlidigegdeptvdggfvnygevdgpytlvkgs
vpgpdkrlvrfrpavrpndqprldpevryvsnesnqg

SCOPe Domain Coordinates for d1vqob1:

Click to download the PDB-style file with coordinates for d1vqob1.
(The format of our PDB-style files is described here.)

Timeline for d1vqob1: