SCOP 1.73: Domain d1vqob1: 1vqo B:1-337

Lineage for d1vqob1 (1vqo B:1-337)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (5 families)

5. Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein)

6. Protein Ribosomal protein L3 [50462] (1 species)
   superfamily fold is elaborated with additional structures

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [50463] (40 PDB entries)

8. Domain d1vqob1: 1vqo B:1-337 [120363]
   Other proteins in same PDB: d1vqo11, d1vqo31, d1vqoa1, d1vqoa2, d1vqoc1, d1vqod1, d1vqoe1, d1vqoe2, d1vqof1, d1vqoh1, d1vqoi1, d1vqoj1, d1vqok1, d1vqol1, d1vqom1, d1vqon1, d1vqoo1, d1vqop1, d1vqoq1, d1vqor1, d1vqos1, d1vqot1, d1vqou1, d1vqov1, d1vqow1, d1vqox1, d1vqoy1, d1vqoz1
   automatically matched to d1jj2b_
   complexed with 1ma, cd, cl, k, mg, na, omg, omu, ppu, psu, sr, ur3

Details for d1vqob1

PDB Entry: 1vqo, 2.2 Å

PDB Description: The structure of CCPMN bound to the large ribosomal subunit haloarcula marismortui

PDB Compounds: (B:) 50S ribosomal protein L3P

SCOP Domain Sequences for d1vqob1:

Sequence; same for both SEQRES and ATOM records:

>d1vqob1 b.43.3.2 (B:1-337) Ribosomal protein L3 {Archaeon Haloarcula marismortui [TaxId: 2238]}
pqpsrprkgslgfgprkrstsetprfnswpsddgqpgvqgfagykagmthvvlvndepns
pregmeetvpvtvietppmravalrayedtpygqrpltevwtdefhseldrtldvpedhd
pdaaeeqirdaheagdlgdlrlithtvpdavpsvpkkkpdvmetrvgggsvsdrldhald
ivedggehamndifrageyadvagvtkgkgtqgpvkrwgvqkrkgkharqgwrrrignlg
pwnpsrvrstvpqqgqtgyhqrtelnkrlidigegdeptvdggfvnygevdgpytlvkgs
vpgpdkrlvrfrpavrpndqprldpevryvsnesnqg

Timeline for d1vqob1:

• d1vqob1 is new in SCOP 1.73
  
• d1vqob1 appears in SCOP 1.75
  
• d1vqob1 appears in the current release, SCOPe 2.08