SCOP 1.73: Domain d1vqo31: 1vqo 3:1-92

Lineage for d1vqo31 (1vqo 3:1-92)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (6 families)

5. Family g.41.8.3: Ribosomal protein L44e [57836] (1 protein)

6. Protein Ribosomal protein L44e [57837] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [57838] (40 PDB entries)

8. Domain d1vqo31: 1vqo 3:1-92 [120360]
   Other proteins in same PDB: d1vqo11, d1vqoa1, d1vqoa2, d1vqob1, d1vqoc1, d1vqod1, d1vqoe1, d1vqoe2, d1vqof1, d1vqoh1, d1vqoi1, d1vqoj1, d1vqok1, d1vqol1, d1vqom1, d1vqon1, d1vqoo1, d1vqop1, d1vqoq1, d1vqor1, d1vqos1, d1vqot1, d1vqou1, d1vqov1, d1vqow1, d1vqox1, d1vqoy1, d1vqoz1
   automatically matched to d1ffkz_
   complexed with 1ma, cd, cl, k, mg, na, omg, omu, ppu, psu, sr, ur3

Details for d1vqo31

PDB Entry: 1vqo, 2.2 Å

PDB Description: The structure of CCPMN bound to the large ribosomal subunit haloarcula marismortui

PDB Compounds: (3:) 50S ribosomal protein L44E

SCOP Domain Sequences for d1vqo31:

Sequence; same for both SEQRES and ATOM records:

>d1vqo31 g.41.8.3 (3:1-92) Ribosomal protein L44e {Archaeon Haloarcula marismortui [TaxId: 2238]}
mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
ptkktdlkyrcgecgkahlregwragrlefqe

Timeline for d1vqo31:

• d1vqo31 is new in SCOP 1.73
  
• d1vqo31 appears in SCOP 1.75
  
• d1vqo31 appears in the current release, SCOPe 2.08