Lineage for d1vqnw1 (1vqn W:1-154)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1655592Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily)
    core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold
  4. 1655593Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family) (S)
  5. 1655594Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins)
  6. 1655595Protein Archaeal L30 (L30a) [55133] (1 species)
    long-chain member of the family; contains additional C-terminal (sub)domain
  7. 1655596Species Haloarcula marismortui [TaxId:2238] [55134] (40 PDB entries)
    Uniprot P14121
  8. 1655606Domain d1vqnw1: 1vqn W:1-154 [120355]
    Other proteins in same PDB: d1vqn11, d1vqn21, d1vqn31, d1vqna1, d1vqna2, d1vqnb1, d1vqnc1, d1vqnd1, d1vqne1, d1vqne2, d1vqnf1, d1vqng1, d1vqnh1, d1vqni1, d1vqnj1, d1vqnk1, d1vqnl1, d1vqnm1, d1vqnn1, d1vqno1, d1vqnp1, d1vqnq1, d1vqnr1, d1vqns1, d1vqnt1, d1vqnu1, d1vqnv1, d1vqnx1, d1vqny1, d1vqnz1
    automatically matched to d1ffkt_
    protein/RNA complex; complexed with cd, cl, k, mg, na, sr

Details for d1vqnw1

PDB Entry: 1vqn (more details), 2.4 Å

PDB Description: the structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (W:) 50S ribosomal protein L30P

SCOPe Domain Sequences for d1vqnw1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqnw1 d.59.1.1 (W:1-154) Archaeal L30 (L30a) {Haloarcula marismortui [TaxId: 2238]}
mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe
tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp
prgghdgvkhpvkeggqlgkhdtegiddlleamr

SCOPe Domain Coordinates for d1vqnw1:

Click to download the PDB-style file with coordinates for d1vqnw1.
(The format of our PDB-style files is described here.)

Timeline for d1vqnw1: