Lineage for d1vqnv1 (1vqn V:1-65)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1077399Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1077416Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) (S)
  5. 1077417Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)
  6. 1077418Protein Ribosomal protein L29 (L29p) [46563] (5 species)
  7. 1077459Species Haloarcula marismortui [TaxId:2238] [46564] (40 PDB entries)
    Uniprot P10971
  8. 1077469Domain d1vqnv1: 1vqn V:1-65 [120354]
    Other proteins in same PDB: d1vqn11, d1vqn21, d1vqn31, d1vqna1, d1vqna2, d1vqnb1, d1vqnc1, d1vqnd1, d1vqne1, d1vqne2, d1vqnf1, d1vqng1, d1vqnh1, d1vqni1, d1vqnj1, d1vqnk1, d1vqnl1, d1vqnm1, d1vqnn1, d1vqno1, d1vqnp1, d1vqnq1, d1vqnr1, d1vqns1, d1vqnt1, d1vqnu1, d1vqnw1, d1vqnx1, d1vqny1, d1vqnz1
    automatically matched to d1ffks_
    protein/RNA complex; complexed with cd, cl, k, mg, na, sr

Details for d1vqnv1

PDB Entry: 1vqn (more details), 2.4 Å

PDB Description: the structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (V:) 50S ribosomal protein L29P

SCOPe Domain Sequences for d1vqnv1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqnv1 a.2.2.1 (V:1-65) Ribosomal protein L29 (L29p) {Haloarcula marismortui [TaxId: 2238]}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

SCOPe Domain Coordinates for d1vqnv1:

Click to download the PDB-style file with coordinates for d1vqnv1.
(The format of our PDB-style files is described here.)

Timeline for d1vqnv1: