Lineage for d1vqnt1 (1vqn T:1-119)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 665509Superfamily b.34.5: Translation proteins SH3-like domain [50104] (6 families) (S)
    many known members contain KOW motif
  5. 665510Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)
  6. 665553Protein Ribosomal proteins L24 (L24p) [50106] (2 species)
  7. 665554Species Archaeon Haloarcula marismortui [TaxId:2238] [50107] (44 PDB entries)
  8. 665579Domain d1vqnt1: 1vqn T:1-119 [120352]
    Other proteins in same PDB: d1vqn11, d1vqn31, d1vqna1, d1vqna2, d1vqnb1, d1vqnc1, d1vqnd1, d1vqne1, d1vqne2, d1vqnf1, d1vqnh1, d1vqni1, d1vqnj1, d1vqnk1, d1vqnl1, d1vqnm1, d1vqnn1, d1vqno1, d1vqnp1, d1vqnq1, d1vqnr1, d1vqns1, d1vqnu1, d1vqnv1, d1vqnw1, d1vqnx1, d1vqny1, d1vqnz1
    automatically matched to d1ffkq_
    complexed with 1ma, aca, btn, cd, cl, hfa, k, mg, na, omg, omu, ppu, psu, sr, ur3

Details for d1vqnt1

PDB Entry: 1vqn (more details), 2.4 Å

PDB Description: the structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (T:) 50S ribosomal protein L24P

SCOP Domain Sequences for d1vqnt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqnt1 b.34.5.1 (T:1-119) Ribosomal proteins L24 (L24p) {Archaeon Haloarcula marismortui [TaxId: 2238]}
skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa

SCOP Domain Coordinates for d1vqnt1:

Click to download the PDB-style file with coordinates for d1vqnt1.
(The format of our PDB-style files is described here.)

Timeline for d1vqnt1: