Lineage for d1vqns1 (1vqn S:1-81)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1016648Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 1016649Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) (S)
  5. 1016650Family d.12.1.1: L23p [54190] (1 protein)
  6. 1016651Protein Ribosomal protein L23 [54191] (4 species)
  7. 1016690Species Haloarcula marismortui [TaxId:2238] [54192] (62 PDB entries)
    Uniprot P12732
  8. 1016701Domain d1vqns1: 1vqn S:1-81 [120351]
    Other proteins in same PDB: d1vqn11, d1vqn21, d1vqn31, d1vqna1, d1vqna2, d1vqnb1, d1vqnc1, d1vqnd1, d1vqne1, d1vqne2, d1vqnf1, d1vqng1, d1vqnh1, d1vqni1, d1vqnj1, d1vqnk1, d1vqnl1, d1vqnm1, d1vqnn1, d1vqno1, d1vqnp1, d1vqnq1, d1vqnr1, d1vqnt1, d1vqnu1, d1vqnv1, d1vqnw1, d1vqnx1, d1vqny1, d1vqnz1
    automatically matched to d1jj2r_
    protein/RNA complex; complexed with cd, cl, k, mg, na, sr

Details for d1vqns1

PDB Entry: 1vqn (more details), 2.4 Å

PDB Description: the structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (S:) 50S ribosomal protein L23P

SCOPe Domain Sequences for d1vqns1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqns1 d.12.1.1 (S:1-81) Ribosomal protein L23 {Haloarcula marismortui [TaxId: 2238]}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqevasri

SCOPe Domain Coordinates for d1vqns1:

Click to download the PDB-style file with coordinates for d1vqns1.
(The format of our PDB-style files is described here.)

Timeline for d1vqns1: