Lineage for d1vqnq1 (1vqn Q:1-95)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2393545Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 2393546Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)
  6. 2393547Protein Ribosomal proteins L21e [50108] (1 species)
  7. 2393548Species Haloarcula marismortui [TaxId:2238] [50109] (40 PDB entries)
    Uniprot P12734
  8. 2393558Domain d1vqnq1: 1vqn Q:1-95 [120349]
    Other proteins in same PDB: d1vqn11, d1vqn21, d1vqn31, d1vqna1, d1vqna2, d1vqnb1, d1vqnc1, d1vqnd1, d1vqne1, d1vqne2, d1vqnf1, d1vqng1, d1vqnh1, d1vqni1, d1vqnj1, d1vqnk1, d1vqnl1, d1vqnm1, d1vqnn1, d1vqno1, d1vqnp1, d1vqnr1, d1vqns1, d1vqnt1, d1vqnu1, d1vqnv1, d1vqnw1, d1vqnx1, d1vqny1, d1vqnz1
    automatically matched to d1ffkn_
    protein/RNA complex; complexed with cd, cl, k, mg, na, sr

Details for d1vqnq1

PDB Entry: 1vqn (more details), 2.4 Å

PDB Description: the structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (Q:) 50S ribosomal protein L21e

SCOPe Domain Sequences for d1vqnq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqnq1 b.34.5.1 (Q:1-95) Ribosomal proteins L21e {Haloarcula marismortui [TaxId: 2238]}
pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt
gtvegkqgdaykvdivdggkektiivtaahlrrqe

SCOPe Domain Coordinates for d1vqnq1:

Click to download the PDB-style file with coordinates for d1vqnq1.
(The format of our PDB-style files is described here.)

Timeline for d1vqnq1: