Lineage for d1vqnp1 (1vqn P:1-143)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 919879Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
    multihelical; consists of two different 3-helical domains connected by a long, partly helical linker
  4. 919880Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) (S)
  5. 919881Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)
  6. 919882Protein Ribosomal protein L19 (L19e) [48142] (1 species)
  7. 919883Species Haloarcula marismortui [TaxId:2238] [48143] (58 PDB entries)
    Uniprot P14119
  8. 919894Domain d1vqnp1: 1vqn P:1-143 [120348]
    Other proteins in same PDB: d1vqn11, d1vqn21, d1vqn31, d1vqna1, d1vqna2, d1vqnb1, d1vqnc1, d1vqnd1, d1vqne1, d1vqne2, d1vqnf1, d1vqng1, d1vqnh1, d1vqni1, d1vqnj1, d1vqnk1, d1vqnl1, d1vqnm1, d1vqnn1, d1vqno1, d1vqnq1, d1vqnr1, d1vqns1, d1vqnt1, d1vqnu1, d1vqnv1, d1vqnw1, d1vqnx1, d1vqny1, d1vqnz1
    automatically matched to d1s72p_
    protein/RNA complex; complexed with cd, cl, k, mg, na, sr

Details for d1vqnp1

PDB Entry: 1vqn (more details), 2.4 Å

PDB Description: the structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (P:) 50S ribosomal protein L19e

SCOPe Domain Sequences for d1vqnp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqnp1 a.94.1.1 (P:1-143) Ribosomal protein L19 (L19e) {Haloarcula marismortui [TaxId: 2238]}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrayghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

SCOPe Domain Coordinates for d1vqnp1:

Click to download the PDB-style file with coordinates for d1vqnp1.
(The format of our PDB-style files is described here.)

Timeline for d1vqnp1: