SCOP 1.73: Domain d1vqnp1: 1vqn P:1-143

Lineage for d1vqnp1 (1vqn P:1-143)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
   multihelical; consists of two different 3-helical domains connected by a long, partly helical linker

4. Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family)

5. Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)

6. Protein Ribosomal protein L19 (L19e) [48142] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [48143] (40 PDB entries)

8. Domain d1vqnp1: 1vqn P:1-143 [120348]
   Other proteins in same PDB: d1vqn11, d1vqn31, d1vqna1, d1vqna2, d1vqnb1, d1vqnc1, d1vqnd1, d1vqne1, d1vqne2, d1vqnf1, d1vqnh1, d1vqni1, d1vqnj1, d1vqnk1, d1vqnl1, d1vqnm1, d1vqnn1, d1vqno1, d1vqnq1, d1vqnr1, d1vqns1, d1vqnt1, d1vqnu1, d1vqnv1, d1vqnw1, d1vqnx1, d1vqny1, d1vqnz1
   automatically matched to d1s72p_
   complexed with 1ma, aca, btn, cd, cl, hfa, k, mg, na, omg, omu, ppu, psu, sr, ur3

Details for d1vqnp1

PDB Entry: 1vqn, 2.4 Å

PDB Description: the structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (P:) 50S ribosomal protein L19e

SCOP Domain Sequences for d1vqnp1:

Sequence; same for both SEQRES and ATOM records:

>d1vqnp1 a.94.1.1 (P:1-143) Ribosomal protein L19 (L19e) {Archaeon Haloarcula marismortui [TaxId: 2238]}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrayghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

Timeline for d1vqnp1:

• d1vqnp1 is new in SCOP 1.73
  
• d1vqnp1 appears in SCOP 1.75
  
• d1vqnp1 appears in the current release, SCOPe 2.08