Lineage for d1vqnn1 (1vqn N:1-186)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 995076Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 996570Superfamily c.55.4: Translational machinery components [53137] (2 families) (S)
  5. 996571Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)
  6. 996572Protein Ribosomal protein L18 (L18p) [53139] (5 species)
  7. 996612Species Haloarcula marismortui [TaxId:2238] [53140] (40 PDB entries)
    Uniprot P14123
  8. 996622Domain d1vqnn1: 1vqn N:1-186 [120346]
    Other proteins in same PDB: d1vqn11, d1vqn21, d1vqn31, d1vqna1, d1vqna2, d1vqnb1, d1vqnc1, d1vqnd1, d1vqne1, d1vqne2, d1vqnf1, d1vqng1, d1vqnh1, d1vqni1, d1vqnj1, d1vqnk1, d1vqnl1, d1vqnm1, d1vqno1, d1vqnp1, d1vqnq1, d1vqnr1, d1vqns1, d1vqnt1, d1vqnu1, d1vqnv1, d1vqnw1, d1vqnx1, d1vqny1, d1vqnz1
    automatically matched to d1ffkk_
    protein/RNA complex; complexed with cd, cl, k, mg, na, sr

Details for d1vqnn1

PDB Entry: 1vqn (more details), 2.4 Å

PDB Description: the structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (N:) 50S ribosomal protein L18P

SCOPe Domain Sequences for d1vqnn1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqnn1 c.55.4.1 (N:1-186) Ribosomal protein L18 (L18p) {Haloarcula marismortui [TaxId: 2238]}
atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas
ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe
gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll
dgdiel

SCOPe Domain Coordinates for d1vqnn1:

Click to download the PDB-style file with coordinates for d1vqnn1.
(The format of our PDB-style files is described here.)

Timeline for d1vqnn1: