Lineage for d1vqnk1 (1vqn K:1-132)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 949112Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
    barrel, closed; n=5, S=8, meander
  4. 949113Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) (S)
  5. 949114Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)
  6. 949115Protein Ribosomal protein L14 [50195] (5 species)
  7. 949159Species Haloarcula marismortui [TaxId:2238] [50197] (42 PDB entries)
    Uniprot P22450
  8. 949169Domain d1vqnk1: 1vqn K:1-132 [120343]
    Other proteins in same PDB: d1vqn11, d1vqn21, d1vqn31, d1vqna1, d1vqna2, d1vqnb1, d1vqnc1, d1vqnd1, d1vqne1, d1vqne2, d1vqnf1, d1vqng1, d1vqnh1, d1vqni1, d1vqnj1, d1vqnl1, d1vqnm1, d1vqnn1, d1vqno1, d1vqnp1, d1vqnq1, d1vqnr1, d1vqns1, d1vqnt1, d1vqnu1, d1vqnv1, d1vqnw1, d1vqnx1, d1vqny1, d1vqnz1
    automatically matched to d1s72k_
    protein/RNA complex; complexed with cd, cl, k, mg, na, sr

Details for d1vqnk1

PDB Entry: 1vqn (more details), 2.4 Å

PDB Description: the structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (K:) 50S ribosomal protein L14P

SCOPe Domain Sequences for d1vqnk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqnk1 b.39.1.1 (K:1-132) Ribosomal protein L14 {Haloarcula marismortui [TaxId: 2238]}
mealgadvtqglekgslitcadntgarelkvisvhgysgtknrlpkaglgdkitvsvtkg
tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
fgsvasaatmiv

SCOPe Domain Coordinates for d1vqnk1:

Click to download the PDB-style file with coordinates for d1vqnk1.
(The format of our PDB-style files is described here.)

Timeline for d1vqnk1: