SCOP 1.73: Domain d1vqnj1: 1vqn J:4-145

Lineage for d1vqnj1 (1vqn J:4-145)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.21: Ribosomal protein L13 [52160] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family)

5. Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein)

6. Protein Ribosomal protein L13 [52163] (2 species)
   synonym: 50S ribosomal protein L13p, HMAL13

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [52164] (44 PDB entries)

8. Domain d1vqnj1: 1vqn J:4-145 [120342]
   Other proteins in same PDB: d1vqn11, d1vqn31, d1vqna1, d1vqna2, d1vqnb1, d1vqnc1, d1vqnd1, d1vqne1, d1vqne2, d1vqnf1, d1vqnh1, d1vqni1, d1vqnk1, d1vqnl1, d1vqnm1, d1vqnn1, d1vqno1, d1vqnp1, d1vqnq1, d1vqnr1, d1vqns1, d1vqnt1, d1vqnu1, d1vqnv1, d1vqnw1, d1vqnx1, d1vqny1, d1vqnz1
   automatically matched to d1ffkg_
   complexed with 1ma, aca, btn, cd, cl, hfa, k, mg, na, omg, omu, ppu, psu, sr, ur3

Details for d1vqnj1

PDB Entry: 1vqn, 2.4 Å

PDB Description: the structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (J:) 50S ribosomal protein L13P

SCOP Domain Sequences for d1vqnj1:

Sequence; same for both SEQRES and ATOM records:

>d1vqnj1 c.21.1.1 (J:4-145) Ribosomal protein L13 {Archaeon Haloarcula marismortui [TaxId: 2238]}
aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr
lsnikfvtlgeisetlganktw

Timeline for d1vqnj1:

• d1vqnj1 is new in SCOP 1.73
  
• d1vqnj1 appears in SCOP 1.75
  
• d1vqnj1 appears in the current release, SCOPe 2.08