Lineage for d1vqnh1 (1vqn H:1-163)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 721795Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 721932Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families) (S)
  5. 721933Family d.41.4.1: Ribosomal protein L10e [54687] (1 protein)
  6. 721934Protein Ribosomal protein L10e [54688] (1 species)
  7. 721935Species Archaeon Haloarcula marismortui [TaxId:2238] [54689] (40 PDB entries)
  8. 721960Domain d1vqnh1: 1vqn H:1-163 [120340]
    Other proteins in same PDB: d1vqn11, d1vqn31, d1vqna1, d1vqna2, d1vqnb1, d1vqnc1, d1vqnd1, d1vqne1, d1vqne2, d1vqnf1, d1vqni1, d1vqnj1, d1vqnk1, d1vqnl1, d1vqnm1, d1vqnn1, d1vqno1, d1vqnp1, d1vqnq1, d1vqnr1, d1vqns1, d1vqnt1, d1vqnu1, d1vqnv1, d1vqnw1, d1vqnx1, d1vqny1, d1vqnz1
    automatically matched to d1s72h_
    complexed with 1ma, aca, btn, cd, cl, hfa, k, mg, na, omg, omu, ppu, psu, sr, ur3

Details for d1vqnh1

PDB Entry: 1vqn (more details), 2.4 Å

PDB Description: the structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (H:) 50S ribosomal protein L10e

SCOP Domain Sequences for d1vqnh1:

Sequence, based on SEQRES records: (download)

>d1vqnh1 d.41.4.1 (H:1-163) Ribosomal protein L10e {Archaeon Haloarcula marismortui [TaxId: 2238]}
kpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvqlrhg
sleasrlsanrhlikelgeegdykmtlrkfphqvlrenkqatgagadrvsdgmraafgki
vgtaarvqageqlftaycnvedaehvkeafrraynkitpscri

Sequence, based on observed residues (ATOM records): (download)

>d1vqnh1 d.41.4.1 (H:1-163) Ribosomal protein L10e {Archaeon Haloarcula marismortui [TaxId: 2238]}
kpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvqlrhg
sleasrlsanrhlikelgeegdykmtlrkfphqvlrenkdgmraafgkivgtaarvqage
qlftaycnvedaehvkeafrraynkitpscri

SCOP Domain Coordinates for d1vqnh1:

Click to download the PDB-style file with coordinates for d1vqnh1.
(The format of our PDB-style files is described here.)

Timeline for d1vqnh1: