SCOP 1.73: Domain d1vqnf1: 1vqn F:1-119

Lineage for d1vqnf1 (1vqn F:1-119)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.3: L30e-like [55315] (3 families)

5. Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (3 proteins)

6. Protein Ribosomal protein L7ae [55319] (4 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [55320] (40 PDB entries)

8. Domain d1vqnf1: 1vqn F:1-119 [120339]
   Other proteins in same PDB: d1vqn11, d1vqn31, d1vqna1, d1vqna2, d1vqnb1, d1vqnc1, d1vqnd1, d1vqne1, d1vqne2, d1vqnh1, d1vqni1, d1vqnj1, d1vqnk1, d1vqnl1, d1vqnm1, d1vqnn1, d1vqno1, d1vqnp1, d1vqnq1, d1vqnr1, d1vqns1, d1vqnt1, d1vqnu1, d1vqnv1, d1vqnw1, d1vqnx1, d1vqny1, d1vqnz1
   automatically matched to d1s72f_
   complexed with 1ma, aca, btn, cd, cl, hfa, k, mg, na, omg, omu, ppu, psu, sr, ur3

Details for d1vqnf1

PDB Entry: 1vqn, 2.4 Å

PDB Description: the structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (F:) 50S ribosomal protein L7Ae

SCOP Domain Sequences for d1vqnf1:

Sequence; same for both SEQRES and ATOM records:

>d1vqnf1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Archaeon Haloarcula marismortui [TaxId: 2238]}
pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
mhipeladekgvpfifveqqddlghaaglevgsaaaavtdageadadvediadkveelr

Timeline for d1vqnf1:

• d1vqnf1 is new in SCOP 1.73
  
• d1vqnf1 appears in SCOP 1.75
  
• d1vqnf1 appears in the current release, SCOPe 2.08