SCOP 1.73: Domain d1vqne2: 1vqn E:80-172

Lineage for d1vqne2 (1vqn E:80-172)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
   consists of two beta-sheets and one alpha-helix packed around single core

4. Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family)

5. Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)

6. Protein Ribosomal protein L6 [56055] (2 species)
   duplication: consists of two domains of this fold

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [56057] (40 PDB entries)

8. Domain d1vqne2: 1vqn E:80-172 [120338]
   Other proteins in same PDB: d1vqn11, d1vqn31, d1vqna1, d1vqna2, d1vqnb1, d1vqnc1, d1vqnd1, d1vqnf1, d1vqnh1, d1vqni1, d1vqnj1, d1vqnk1, d1vqnl1, d1vqnm1, d1vqnn1, d1vqno1, d1vqnp1, d1vqnq1, d1vqnr1, d1vqns1, d1vqnt1, d1vqnu1, d1vqnv1, d1vqnw1, d1vqnx1, d1vqny1, d1vqnz1
   automatically matched to d1ffk12
   complexed with 1ma, aca, btn, cd, cl, hfa, k, mg, na, omg, omu, ppu, psu, sr, ur3

Details for d1vqne2

PDB Entry: 1vqn, 2.4 Å

PDB Description: the structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (E:) 50S ribosomal protein L6P

SCOP Domain Sequences for d1vqne2:

Sequence; same for both SEQRES and ATOM records:

>d1vqne2 d.141.1.1 (E:80-172) Ribosomal protein L6 {Archaeon Haloarcula marismortui [TaxId: 2238]}
weygmevfyshfpmqvnvegdevvienflgekaprrttihgdtdveidgeeltvsgpdie
avgqtaadieqltrindkdvrvfqdgvyitrkp

Timeline for d1vqne2:

• d1vqne2 is new in SCOP 1.73
  
• d1vqne2 appears in SCOP 1.75
  
• d1vqne2 appears in the current release, SCOPe 2.08